PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G287500.1
Common NameB456_007G287500, LOC105804745
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 388aa    MW: 43044.4 Da    PI: 7.0304
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G287500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.28.7e-343589155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprl+Wtp+LHerF+eav+qLGG++kAtPkt+++lm+++gLtl+h+kSHLQkYRl
  Gorai.007G287500.1 35 KPRLKWTPDLHERFIEAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRL 89
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.0143292IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-313390IPR009057Homeodomain-like
SuperFamilySSF466897.88E-173490IPR009057Homeodomain-like
TIGRFAMsTIGR015573.7E-233590IPR006447Myb domain, plants
PfamPF002494.4E-103788IPR001005SANT/Myb domain
PfamPF143793.0E-24136182IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MYQHQGKNIH PERHLFLQGG NGPGDSGLVL STDAKPRLKW TPDLHERFIE AVNQLGGADK  60
ATPKTVMKLM GIPGLTLYHL KSHLQKYRLS KNLHGQANNG SNKIGAVAMT GDRMSEATGT  120
HMNNLSIGPQ TNKGLQIGEA LQMQIEVQRR LHEQLEVQRH LQLRIEAQGK YLQAVLEKAQ  180
ETLGRQNLGN MGLEAAKVQL SELVSKVSNQ CLNSAFSDLK DLQGLCPQQG QTQATPPTDC  240
SMDSCLTSCD GSQKEQEIHN NGIFLRTYNS TSFMEQRDHV PEDRLVPQTE LKPFTDMKLG  300
NDAERRMFFA DRSTSDLSMS VGLQGEKGHG SFSEGKFNGR NEDQEGFKLQ TVNRLPYFAT  360
KLDLNVHEEV DAASSCKQFD LNGLSWN*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00331DAPTransfer from AT3G04030Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012492934.10.0PREDICTED: uncharacterized protein LOC105804745
TrEMBLA0A0D2TNC10.0A0A0D2TNC1_G
STRINGPOPTR_0013s05670.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33362764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-150G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]